122890-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG1,kClone Number
1D1Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_003500, NP_003491Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-ACOX2 (Acyl-Coenzyme A Oxidase 2, Branched Chain, BCOX, BRCACOX, BRCOX, THCCox, Peroxisomal Branched Chain Acyl-CoA Oxidase, THCA-CoA Oxidase, Trihydroxycoprostanoyl-CoA Oxidase) (APC)
ACOX2 belongs to the acyl-CoA oxidases family. It is a branched-chain acyl-CoA oxidase, and is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. It oxidizes the CoA esters of the bile acid intermediates di- and tri-hydroxycholestanoic acids. Mutations resulting in the deficiency of ACOX2 lead to the accumulation of branched fatty acids and bile acid intermediates.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa582-682 from ACOX2 (NP_003491) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ACOX2.
