122903-ML490
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™490Isotype
IgG2a,kClone Number
3G4Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_001995, NP_001986Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1, Acyl-CoA Synthetase 1, ACS1, FACL1, FACL2, LACS, Long-chain-fatty-acid-CoA Ligase 1, Long-chain Fatty Acid-CoA Ligase 2, Long-chain Acyl-CoA Synthetase 1, LACS 1, LACS1, Long-chain Acyl-CoA Synthetase 2, LACS 2, LACS2, Palmitoyl-CoA Ligase 1, Palmitoyl-CoA Ligase 2) (MaxLight 490)
MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Mammalian long-chain acyl-CoA synthetase (ACSL) catalyzes the ligation of the fatty acid to CoA to form fatty acyl-CoA in a two-step reaction. Five isoforms of ACSL have been identified. These isoforms have different substrate preferences and subcellular localizations. Overexpression of ACSL1 results in changes of fatty acid metabolism in rat primary hepatocytes.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa48-145 from human ACSL1 (NP_001986) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ACSL1.