Mouse Anti-ADAMTS2 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 2, ADAM-TS 2, ADAM-TS2, ADAMTS-2, Procollagen I N-proteinase, PC I-NP, Procollagen I/II Amino Propeptide-processing Enzyme, Procollagen N-endopeptidase, pNPI, PCINP, PCPNI)
Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa1112-1210 from ADAMTS2 (NM_014244, NP_055059) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ADAMTS2. Species Crossreactivity: rat.
