Alpha-fetoprotein (AFP) is a serum glycoprotein protein produced in the liver or yolk sac of fetal staged mammals. AFP synthesis is minimal after birth and trace amount is expressed in the adult liver. AFP gene expression is regulated by the interactions between steroid hormone receptors and transcriptional factors in separate signal transduction pathways. AFP functions as a binding and transporting ligand and cell growth regulator. An elevated expression level of AFP has been implicated in colorectal, ovarian, pancreatic, testicular, and certain liver cancers. High level of AFP is also seen some diseases, such as hepatitis and colitis. AFP is used as a screening marker for fetal abnormalities in pregnant women, such as Down syndrome. Recently, AFP has been introduced as an anti-cancer drug-ligand carrier, transporting drugs to target tumor cells, increasing anti-tumor efficiency.

Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunoprecipitation. Other applications not tested.

Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher.

CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa500-609 from human AFP (AAH27881) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human AFP.