AGR3 (Anterior Gradient 3) protein, also known as AG3 (hAG3, HAG3 in human), or BCMP11, is a secreted cytoplasmic protein which is involved in metastasis induction and p53 tumor supressor inhibition. It may serve as molecular marker and potential therapeutic target for hormone-responsive breast tumors. Its Xenopus homolog is associated with anteroposterior fate determination during early development.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human AGR3, aa1-166 (NP_789783.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human AGR3.