123164-Biotin
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
BiotinIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_003739.4, NP_003730.4Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Rabbit Anti-AKR1C3 (DDH1, HSD17B5, KIAA0119, PGFS, Aldo-keto Reductase Family 1 Member C3, 17-beta-hydroxysteroid Dehydrogenase Type 5, 3-alpha-HSD Type II, Brain, 3-alpha-hydroxysteroid Dehydrogenase Type 2, Chlordecone Reductase Homolog HAKRb, Dihydrodiol Dehydrogenase 3, Dihydrodiol Dehydrogenase Type I, HA1753, Indanol Dehydrogenase, Prostaglandin F Synthase, Testosterone 17-beta-dehydrogenase 5, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase) (Biotin)
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human AKR1C3, aa1-323 (NP_003730.4).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human AKR1C3.