123269-HRP
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
HRPIsotype
IgG2b,kClone Number
3E11Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
BC008302, AAH08302Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-ALS2CR2 (STE20-related Kinase Adapter Protein beta, STRAD beta, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 2 Protein, CALS-21, ILP-interacting Protein, Pseudokinase ALS2CR2, STRADB, ILPIP, PRO1038) (HRP)
ALS2CR2, a novel anti-apoptotic protein, belongs to the serine/threonine protein kinase STE20 subfamily. Due to the presence of a protein kinase domain with one of the active site residues altered, ALS2CR2 is known as pseudokinase. ALS2CR2 is a component of a complex involved in the activation of a master kinase serine/threonine kinase 11, that regulates cell polarity and energy-generating metabolism and is known to regulate the relocation of this kinase from the nucleus to the cytoplasm. It is essential for G1 cell cycle arrest mediated by this kinase. ALS2CR2 is known to interact with the X chromosome-linked inhibitor of apoptosis protein, and thus enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa319-418 from human ALS2CR2 (AAH08302) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ALS2CR2.