Mouse Anti-AMACR (Alpha-methylacyl-CoA Racemase, 2-methylacyl-CoA Racemase)
Alpha-methyacyl-CoA racemase (AMCR), is an enzyme invloved in beta oxidation of branched chain fatty acids and bile salt intermediates, and has recently been identified as a neomarker for prostate cancer, where it is over expressed. Several different isoforms have been reported that are produced either by extensinve alternatve splicing of 5 exons or by use of alternate initiation codons. At least 2 different transcripts, each derived from the 5 exons, have been reported, AMCR I and AMCR II. AMCR I is the most abundant form and enclodes for a 382aa protein (42kD). The other isoform AMCR II exhibits significant homolgy to fumarate hydratase and encodes a 288aa protein (32kD). Several other variants of IA and IIA isoforms have been characterized recently.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full-length recombinant protein corresponding to aa1-198 from human AMACR with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4
Purity
Purified by Protein A affinity chromatography
Specificity
Recognizes human AMACR
