Mouse Anti-ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882)
Anaphase-promoting complex (APC) is homologous to the two highly conserved RING finger proteins ROC1 and ROC2. APC11 specifically interacts with APC2, a cullin-related APC subunit. ROC1 and APC11 immunocomplexes can catalyze isopeptide ligations to form polyubiquitin chains in an E1-and E2-dependent manner. Combinations of ROC/APC11 and cullin proteins potentially constitute a wide variety of ubiquitin ligases.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant corresponding to aa1-55 from human ANAPC11 (AAH00607) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ANAPC11.