123314-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG1,kClone Number
1G3Grade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
HuAccession #
NM_000044, NP_000035Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-Androgen Receptor (Dihydrotestosterone Receptor, Nuclear Receptor Subfamily 3 Group C Member 4, AR, DHTR, NR3C4) (PE)
The Androgen Receptor (AR) is a 90kD steroid hormone receptor that is critical for the development and function of the male reproductive system. AR binding to testosterone or 5a-dihydrotestosterone (DHT) triggers receptor dimerization followed by translocation to the nucleus where it promotes transcription of androgen responsive genes. Multiple polymorphisms in AR are linked to the development of prostate cancer. The ligand binding domain of human AR aa661-920 shares aa sequence identity with mouse and rat AR.
Applications
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa221-320 from human AR (NP_000035) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human AR.
