123321-PE
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
PEIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
Hu MoAccession #
NM_139314, NP_647475.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Rabbit Anti-ANGPTL4 (Angiopoietin-related Protein 4, Angiopoietin-like Protein 4, Hepatic Fibrinogen/Angiopoietin-related Protein, HFARP, ARP4, HFARP, PGAR, PP1158, PSEC0166, UNQ171/PRO197) (PE)
Angiopoietin-like protein 4 (ANGPTL4), also known as PPAR angiopoietinrelated protein, fasting-induced adipose factor, or hepatic fibrinogen /angiopoietin-related protein (HFARP), is a secreted adipokine predominantly expressed in adipose tissue and liver. The experimental results show that ANGPTL4 is a blood-borne hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. Serum levels of ANGPTL4 were decreased in patients with type 2 diabetes. In animal experiments, ANGPTL4 treatments might reduce hyperglycemia, and improve glucose tolerance by decreasing hepatic glucose production and enhancing insulin-mediated inhibition of gluconeogenesis. However, the molecular mechanisms underlying its metabolic actions remain elusive.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human ANGPTL4, aa1-406 (NP_647475.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ANGPTL4. Species Crossreactivity: mouse.