123323-FITC
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
FITCIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_178127.2, NP_835228.1Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Rabbit Anti-ANGPTL5 (Angiopoietin-related Protein 5, Angiopoietin-like Protein 5, UNQ5795/PRO19600) (FITC)
Angiopoietin-like 5 (ANGPTL5) is a secreted glycoprotein that is structurally related to the angiopoietins which contain an N-terminal coiled-coil domain and a C-terminal fibrinogen-like domain. It shares 88% and 93% aa sequence identity with bovine and porcine ANGPTL5, and greater than 98% identity with chimpanzee, orangutan, and rhesus ANGPTL5. ANGPTL5 is expressed in adipose, bronchial, epididymal, and heart tissue. Rare polymorphisms and loss of function mutations in human ANGPTL5 are associated with low circulating triglyceride levels and alterations in body mass index. ANGPTL5, when used in combination with other growth factors such as SCF, Thrombopoietin, IGF-II, FGF acidic, Flt-3 Ligand, and IGFBP-2, enhances the expansion and engraftment of human and mouse hematopoietic stem cells. The coiled-coil domain of ANGPTL proteins is critical for this effect. However, the molecular mechanism of ANGPTL proteins in stem cell activity remains unclear.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFEVMCDMDYRGGGWTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKLLATGIQWGTWTKNNSPVKIKSVSMKIRRMYNPYFK
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human ANGPTL5, aa1-388 (NP_835228.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ANGPTL5.