123325-ML490
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™490Isotype
IgG2a,kClone Number
3H8Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_031917, NP_114123Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-ANGPTL6 (Angiopoietin-related Protein 6, Angiopoietin-like Protein 6, Angiopoietin-related Growth Factor, Angiopoietin-related Protein 5, UNQ152/PRO178, AGF, ARP5) (MaxLight 490)
MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Angiopoietin-like 6 (ANGPTL6), also known as angiopoietin related growth factor (AGF), is a secreted 50kD protein that contains a coiled coil domain aa51-77, 126-164 and a fibrinogen-like domain aa238-456. A conserved Integrin binding RGD motif is located within the fibrinogen-like domain. This enables ANGPTL6 to promote skin wound healing by mediating the adhesion and migration of keratinocytes, fibroblasts, and endothelial cells. ANGPTL6 also promotes the chemotaxis of vascular endothelial cells resulting in increased vascular permeability and angiogenesis. ANGPTL6 is also secreted by hepatocytes. It inhibits gluconeogenesis in these cells and promotes insulin sensitivity and energy expenditure in mice fed high fat diets. Serum levels of ANGPTL6 are elevated in metabolic syndrome, diabetes, and preeclampsia but are decreased in chronic renal failure. ANGPTL6 is additionally produced by several hematopoietic cell types including megakaryocytes, platelets, mast cells, and uterine NK cells. Mature mouse ANGPTL6 shares 75% and 95% sequence identity with human and rat ANGPTL6.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVI
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa211-300 from human ANGPTL6 (NP_114123) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ANGPTL6.