Mouse Anti-AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19, Golgi Adaptor HA1/AP1 Adaptin sigma-1A Subunit, HA1 19kD Subunit, Sigma 1a Subunit of AP-1 Clathrin, Sigma-adaptin 1A, Sigma1A-adaptin, AP19, CLAPS1)
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human AP1S1, aa1-158 (NP_001274.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human AP1S1.
