123380-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG2a,kClone Number
3E4Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC006337, AAH06337Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit, AP2 Complex Subunit sigma 1, AP-2 Complex Subunit sigma 1, AP 17, AP17, AP17 delta, Clathrin Assembly Protein 2 Small Chain, Clathrin-associated/assembly/adaptor Protein Small 2, CLAPS2, Clathrin Coat Assembly Protein AP17, Clathrin Coat-associated Protein AP17, HA2 17kD Subunit, Plasma Membrane Adaptor AP-2 17kD Protein) (PE)
Adapter-related protein complex 2 sigma-1 subunit (AP2S1, AP17) is the component of the adaptor complexes which links clathrin to receptors in coated vesicles.It is the smallest polypeptide chain component of AP-2, a heterotetramer composed of two large adaptins (alpha-type subunit, AP2 alpha, and beta-type subunit, AP2 beta), a medium adaptin (mu-type subunit, AP2 mu1) and a small adaptin (sigma-type subunit, AP2S1).AP-2 is one of two major clathrin-associated protein complexes that interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-142 from human AP2S1 (AAH06337) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human AP2S1.