123404-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG2b,kClone Number
4B5Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
BC000373, AAH00373Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-APLP2 (Amyloid-like Protein 2, APLP-2, Amyloid Protein Homolog, APPH, APPL2, CDEBP, CDEI Box-binding Protein) (PE)
Amyloid beta precursor-like protein 2 (APLP-2) is a 120-170kD member of the APP family of neuronal type I transmembrane proteins. Its extracellular domain consists of an N-terminal Cys-rich domain, an Asp/Glu-rich acidic region, a Kunitz protease inhibitor (KPI) domain, and a GAG attachment site in the membrane proximal domain. APLP-2 forms both homodimers and heterodimers with APP and APLP-1. Proteolytic cleavage of APLP-2 generates peptides similar to the amyloidogenic Ab peptides and a cytoplasmic fragment that functions as a transcriptional coactivator. Alternate splicing of APLP-2 generates isoforms that lack the KPI domain or contain an insertion that prevents GAG attachment. The extracellular domain of human APLP-2 shares 81%, 93% aa sequence identity with mouse and rat APLP-2, respectively.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
AGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQ
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa41-150 from human APLP2 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human APLP2.