123426
Clone Type
MonoclonalHost
MouseSource
HumanIsotype
IgG1,kClone Number
3H2Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_004631, NP_004622Shipping Temp
Blue IceStorage Temp
-20°CMouse Anti-APOER2 (Low Density Lipoprotein Receptor-related Protein 8, LRP-8, Apolipoprotein E Receptor 2, LRP8)
LPR8 is an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa83-170 from human APOER2 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4
Purity
Purified by Protein A affinity chromatography
Specificity
Recognizes human APOER2
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1.PCSK9 is not involved in the degradation of LDL receptors and BACE1 in the adult mouse brain. 1. Liu M, Wu G, Baysarowich J, Kavana M, Addona GH, Bierilo KK, Mudgett JS, Pavlovic G, Sitlani A, Renger JJ, Hubbard BK, Fisher TS, Zerbinatti CV.J Lipid Res. 2010 Sep;51(9):2611-8. Epub 2010 May 7.USBio References
No references available