Mouse Anti-ARF6 (ADP-ribosylation Factor 6)
ADP-Ribosylation Factor 6 (ARF6) is a GTP-binding protein that functions as a regulator of cytoskeleton remodeling and endocytic recycling. ARF6 is an allosteric activator of cholera toxin catalytic subunit, an ADP-ribosyltransferase. It may also be involved in the modulation of vesicle budding and uncoating with the Golgi apparatus.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant corresponding to aa1-175 from human ARF6 (AAH08918) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in ascites fluid.
Specificity
Recognizes human ARF6.
