123720-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG2b,kClone Number
7A4Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_152565, NP_689778Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-ATP6V0D2 (V-type Proton ATPase Subunit D 2, V-ATPase Subunit D 2, Vacuolar Proton Pump Subunit D 2) (PE)
Vacuolar ATPase (V ATPase) is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c', c'' and d). It is responsible for acidifying a variety of intracellular organelles in eukaryotic cells. ATP6V0D2 is a component of the integral membrane V0 complex of vacuolar ATPase and may have a role in coupling of proton transport and ATP hydrolysis. ATP6V0D2 may be involved in regulation of osteoclast fusion and bone formation.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Sandwich FLISA: The detection limit for recombinant GST tagged ATP6V0D2 is 0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa238-307 from human ATP6V0D2 (NP_689778) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ATP6V0D2.