123731-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG2b,kClone Number
3D5Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_144583, NP_653184Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-ATP6V1C2 (V-type Proton ATPase Subunit C 2, V-ATPase Subunit C 2, Vacuolar Proton Pump Subunit C 2) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Sandwich FLISA: The detection limit for recombinant GST tagged ATP6V1C2 is ~0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYD
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa188-254 from human ATP6V1C2 (NP_653184) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ATP6V1C2.
