Mouse Anti-B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3, BGnT-3, Beta-1,3-Gn-T3, Beta-1,3-N-acetylglucosaminyltransferase 3, Beta3Gn-T3, Beta-1,3-galactosyltransferase 8, Beta-1,3-GalTase 8, Beta3Gal-T8, Beta3GalT8, b3Gal-T8, Beta-3-Gx-T8, Core 1 Extending beta-1,3-N-acetylglucosaminyltransferase, Core1-beta3GlcNAcT, Transmembrane Protein 3, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8, UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8, B3GALT8, TMEM3, UNQ637/PRO1266)
Has a beta-1,3-N-acetylglucosaminyltransferase activity for type 2 oligosaccharides.
Applications
Suitable for use in ELISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa135-208 from B3GNT3 (NP_055071) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human B3GNT3.
