In breast cancer, the antiestrogen tamoxifen has been prescribed for both primary treatment and the treatment of advanced metastatic disease. Although the drug induces remission in most patients with estrogen receptor-positive disease, all patients eventually develop resistance. van Agthoven et al. (1998) applied an insertional mutagenesis strategy to a breast cancer cell line. Infected cells were subjected to tamoxifen selection, and the resistant clones were screened for a common integration site linked with antiestrogen resistance. By screening a human testis cDNA library with the integration site-specific probe, they obtained a cDNA encoding BCAR3 (breast cancer antiestrogen resistance 3). The deduced 825aa BCAR3 protein contains a putative Src homology 2 (SH2) domain and sequences homologous to yeast CDC48. Northern blot analysis detected abundant expression of a 3.4kb BCAR3 transcript in heart, placenta, skeletal muscle, spleen, prostate, testis, ovary, small intestine, colon, fetal kidney, and several cancer cell lines, but not in nonmalignant breast tissue; a 6kb BCAR3 transcript was also detected in skeletal muscle and heart.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa266-373 from BCAR3 (AAH39895)with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human BCAR3.