Mouse Anti-BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Bim belongs to Bcl-2 family of proteins containing Bcl-2 homology domain3 (BH3). It is proapoptotic and exerts its effects by interacting with prosurvival members of the Bcl-2 family like Bcl-2, Bcl-XL and Bcl-w. It exhibits three splice variants; BimL, BimS and BimEL. They all share homology in their C-terminal BH3 domain and are ubiquitously expressed. BimS is the strongest of them with respect to the proapoptotic capacity.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-100 from human BIM with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human BIM.