The bromodomain is a conserved 110aa motif which specifically interacts with acetyl-lysines, at least in the context of short histone H3 and H4 peptides. Although bromodomains have now been found in more than 40 different proteins, the function of this motif is poorly understood. The association of two N-terminal bromodomains with a C-terminal extraterminal (ET) domain defines the Fsh/Brd subgroup, which includes members in many species. In vertebrates, four members of the Fsh/Brd subgroup have now been identified: Brd2/RING3/fsrg1, Brd3/ORFX/fsrg2, Brd4/HUNK1/MCAP, and Brd5/BRDT. The Brd3/ORFX gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known.

Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.

Immunohistochemistry: Formalin fixed paraffin embedded. Optimal dilutions to be determined by the researcher.

EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant protein corresponding to aa418-556 from BRD3 with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human BRD3.