123996-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG1,kClone Number
6E7Grade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
HuAccession #
BC032124, AAH32124Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-BRD3 (Bromodomain-containing Protein 3, RING3-like Protein, KIAA0043, RING3L) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
The bromodomain is a conserved 110aa motif which specifically interacts with acetyl-lysines, at least in the context of short histone H3 and H4 peptides. Although bromodomains have now been found in more than 40 different proteins, the function of this motif is poorly understood. The association of two N-terminal bromodomains with a C-terminal extraterminal (ET) domain defines the Fsh/Brd subgroup, which includes members in many species. In vertebrates, four members of the Fsh/Brd subgroup have now been identified: Brd2/RING3/fsrg1, Brd3/ORFX/fsrg2, Brd4/HUNK1/MCAP, and Brd5/BRDT. The Brd3/ORFX gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known.
Applications
Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilution
Immunohistochemistry: Formalin fixed paraffin embedded. Optimal dilutions to be determined by the researcher.
AA Sequence
EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa418-556 from BRD3 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human BRD3.