Mouse Anti-RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929)
Probable E3 ubiquitin-protein ligase that may play a role in angiogenesis. May also have an ATPase activity.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa2016-2113 from human C17orf27 (NP_065965) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human C17orf27.
