124200-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG2a,kClone Number
2G2Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_012295, NP_036427Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-CABIN1 (Calcineurin-binding Protein Cabin-1, Calcineurin Inhibitor, CAIN, KIAA0330) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Calcineurin is a widely distributed Ser/Thr, calcium and calmodulin-dependent protein phosphatase. It mediates the immunosuppressive actions of drugs such as FK506 and cyclosporin, and has also been implicated in a number of calcium-sensitive pathways in the nervous system. Calcineurin has been found to be associated with other proteins, such as calmodulin, FKBP12, the ryanodine receptor, inositol 1,4,5-trisphosphate, and a recently identified protein, calcineurin inhibitor (CAIN). CAIN has been shown to bind calcineurin through its C-terminal tail. Recent studies have shown CAIN to bind to both amphiphysin 1 and calcineurin simultaneously and therefore acts as a physiological inhibitor of calcineurin. The binding of CAIN to amphiphysin 1 does not affect the interaction of amphiphysin 1 with other endocytic proteins. CAIN, like calcineurin, is highly expressed in neurons and other tissues.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAM*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from CABIN1 (NP_036427) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CABIN1.