Technical Data

124401-APC
Clone Type
Monoclonal
Host
Mouse
Source
Human
Conjugate
APC
Isotype
IgG2a,k
Clone Number
3E1
Grade
Affinity Purified
Applications
FLISA IHC IP WB
Crossreactivity
Hu
Accession #
NM_000071, NP_000062
Shipping Temp
Blue Ice
Storage Temp
4°C Do Not Freeze
Notes
BSA Free
Mouse Anti-CBS (Cystathionine beta-synthase, Serine Sulfhydrase, Beta-thionase) (APC)

CBS acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. This protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria.

Applications
Suitable for use in FLISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human CBS (NP_000062) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CBS.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.

References
1. Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe. Dufton N, Natividad J, Verdu EF, Wallace JL.Sci Rep. 2012;2:499. Epub 2012 Jul 9. 2. Characterization of Hydrogen Sulfide and Its Synthases, Cystathionine ?]-Synthase and Cystathionine ?^-Lyase, in Human Prostatic Tissue and Cells. Guo H, Gai JW, Wang Y, Jin HF, Du JB, Jin J.Urology. 2012 Feb;79(2):483.e1-5. 3. Homocystinuria in Taiwan: An inordinately high prevalence in an Austronesian aboriginal tribe, Tao. Lu YH, Huang YH, Cheng LM, Yu HC, Hsu JH, Wu JT, Lo MY, Lin A, Lin CY, Wu JY, Niu DM.Molecular Genetics and Metabolism (2012), doi: 10.1016/j. ymgme.2012.01.021 4. Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation. Streeter E, Al-Magableh M, Hart JL, Badoer E.Front Physiol. 2011;2:55. Epub 2011 Sep 1. 5. Interdependency of Cystathione ?^-Lyase and Cystathione ?]-Synthase in Hydrogen Sulfide-Induced Blood Pressure Regulation in Rats. Roy A, Khan AH, Islam MT, Prieto MC, Majid DS.Am J Hypertens. 2011 Aug 25. doi: 10.1038/ajh.2011.149. [Epub ahead of print] 6. Placental markers of folate-related metabolism in preeclampsia. Mislanova C, Martsenyuk O, Huppertz B, Obolenskaya MY.Reproduction. 2011 Jun 20. [Epub ahead of print] 7. Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats. Ren YS, Wu SY, Wang XJ, Yu F, Zhao J, Tang CS, Ouyang JP, Geng B.Chin Med J 2011;124(21):3468-3475. 8. Hydrogen Sulfide Modulates Contractile Function in Rat Jejunum. Kasparek MS, Linden DR, Farrugia G, Sarr MG.J Surg Res. 2011 Apr 22. [Epub ahead of print] 9. Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine beta-synthase. Yamamoto T, Takano N, Ishiwata K, Suematsu M.J. Clin. Biochem. Nutr., 48, 96-100, 2010. 10. The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction. Predmore BL, Alendy MJ, Ahmed KI, Leeuwenburgh C, Julian D.Age (Dordr). 2010 Dec;32(4):467-81. Epub 2010 May 26. 11. A Crucial Role for Hydrogen Sulfide in Oxygen Sensing via Modulating Large Conductance Calcium-Activated Potassium Channels. Li Q, Sun B, Wang X, Jin Z, Zhou Y, Dong L, Jiang LH, Rong W.Antioxid Redox Signal. 2010 May 15;12(10):1179-89. 12. Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes. Majtan T, Liu L, Carpenter JF, Kraus JP.J Biol Chem. 2010 Mar 22. [Epub ahead of print] 13. Actions of hydrogen sulphide on ion transport across rat distal colon. Hennig B, Diener M.Br J Pharmacol. 2009 Nov;158(5):1263-75. Epub 2009 Sep 25. 14. The endogenous hydrogen sulfide producing enzyme cystathionine-?] synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome. Xu GY, Winston JH, Shenoy M, Zhou S, Chen JD, Pasricha PJ.Mol Pain. 2009 Aug 6;5:44. 15. Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide. Lee M, Schwab C, Yu S, McGeer E, McGeer PL.Neurobiol Aging. 2009 Oct;30(10):1523-34. Epub 2009 Jul 23. 16. Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract. Martin GR, McKnight GW, Dicay MS, Coffin CS, Ferraz JG, Wallace JL.Dig Liver Dis. 2009 Jun 29. [Epub ahead of print] 17. Endogenous and Exogenous Hydrogen Sulfide Promotes Resolution of Colitis in Rats. Wallace JL, Vong L, McKnight W, Dicay M, Martin GR.Gastroenterology. 2009 Aug;137(2):569-78, 578.e1. Epub 2009 Apr 16. 18. Active CBS can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone. Majtan T, Singh LR, Wang L, Kruger WD, Kraus JP.J Biol Chem. 2008 Dec 12;283(50):34588-95. Epub 2008 Oct 10. 19. Hydrogen sulfide enhances ulcer healing in rats. Wallace JL, Dicay M, McKnight W, Martin GR.FASEB J. 2007 Dec;21(14):4070-6. Epub 2007 Jul 18. 20. Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon. Schicho R, Krueger D, Zeller F, Von Weyhern CW, Frieling T, Kimura H, Ishii I, De Giorgio R, Campi B, Schemann M.Gastroenterology. 2006 Nov;131(5):1542-52. Epub 2006 Aug 18.
USBio References
No references available
United States Biological | 4 Technology Way | Salem, MA 01970
Phone 800-520-3011 | Fax 978-594-8052 | Website www.usbio.net