Mouse Anti-CCL19 (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, MIP3B, SCYA19, MGC34433)
The gene for CCL19 is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.
Applications
Suitable for use in ELISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full-length recombinant corresponding to aa1-99 from human CCL19 with GST tag.
Form
Supplied as a liquid in ascites fluid.
Specificity
Recognizes human CCL19.
