124482
Clone Type
MonoclonalHost
MouseSource
HumanIsotype
IgG2a,kClone Number
1B8Grade
Affinity PurifiedApplications
E IF IHC WBCrossreactivity
HuAccession #
BC005280, AAH05280Shipping Temp
Blue IceStorage Temp
-20°CMouse Anti-CCNH (Cyclin H, Cyclin-H, MO15-associated Protein, p34, p37)
Regulated progression through the cell cycle requires sequential expression of a family of proteins called cyclins. Upon their induction, cyclins form complexes with specific cyclin-dependent kinases (CDKs), creating active holoenzymes that phosphorylate target proteins required for cell-cycle progression. In humans, the CDK/Cyclin H complex regulates the CDK-activating kinase (CAK). CAK is involved in activation of RNA polymerase II when complexed with the core-TFIIH basal transcription factor, allowing for elongation of transcripts. However, the function of the Cyclin H ortholog in zebrafish has not yet been isolated. One study has shown Cyclin H to be present throughout early stages of development, and experiments with defective Cyclin H suggest that it plays a vital role in this area.
Applications
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAF
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-110 from human CCNH (AAH05280) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CCNH.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair. Nakazawa Y, Sasaki K, Mitsutake N, Matsuse M, Shimada M, Nardo T, Takahashi Y, Ohyama K, Ito K, Mishima H, Nomura M, Kinoshita A, Ono S, Takenaka K, Masuyama R, Kudo T, Slor H, Utani A, Tateishi S, Yamashita S, Stefanini M, Lehmann AR, Yoshiura KI, Ogi T.Nat Genet. 2012 Apr 1. doi: 10.1038/ng.2229. [Epub ahead of print]USBio References
No references available