Rabbit Anti-CCRK (Cell Division Protein Kinase 20, Cell Cycle-related Kinase, Cyclin-kinase-activating Kinase p42, CDK-activating Kinase p42, CAK-kinase p42, Cyclin-dependent Protein Kinase H, CDK20, CDCH) (Not for Export EU)
CCRK contains a kinase domain most closely related to the cyclin-dependent protein kinases. This protein is involved in cell growth and activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue Thr-160.
Applications
Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human CCRK, aa1-275 (AAH02655.1).
Form
Supplied as a liquid.
Specificity
Recognizes human CCRK. Species Crossreactivity: mouse.
