Rabbit Anti-CD160 (CD160 Antigen, Natural Killer Cell Receptor BY55, BY55) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
CD160 is a 27kD member of Ig superfamily of molecules. It is expressed on select hematopoietic cell types, including CD56dimCD16+ cytotoxic NK cells, CD8+CD28 effector T cells, YdT cells, and restricted CD4+ T cells. It is a receptor for HLAC molecules, and its engagement induces CD160+ NK cells to both secrete IFN-Y plus TNF-A, and initiate a cytotoxic program. Human CD160 was originally identified as a 155aa pro-protein aa27-181. It contains a 132aa mature region aa27-159 and a C-terminal pro-segment that is cleaved to create a GPI linkage. The mature region possesses one V-type Ig-like domain aa27-122. CD160 is found as a soluble, disulfide-linked 80kD multimer (likely trimer) that is generated by proteolysis of the GPI-linked form. This 80kD form, plus others, are highly resistant to reduction. There is also a 100-110kD multimeric transmembrane (TM) form that is associated with activated NK cells. It contains a 55aa substitution for aa180-181, and shows a 20aa TM segment between aa163- 182. The TM form appears to have a splice variant that lacks aa25-133. Over aa27-159, human CD160 shares only 62% aa sequence identity with mouse CD160.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full-length human CD160, aa1-181 (AAH14465.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CD160.