124551-ML650
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
MaxLight™650Isotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_000639, AAH17502.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Rabbit Anti-CD178 (Apoptosis Antigen Ligand, APT1LG1, APTL, CD95 Ligand, CD95L, CD95-L, FAS Antigen Ligand, Fas Ligand, FASL, FASLG, Tumor Necrosis Factor Ligand Superfamily Member 6, TNFSF6) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
FAS Ligand (FASL) is a 40kD type II membrane protein belonging to the tumor necrosis factor family, which induces apoptosis by binding to its receptor, Fas. The human FasL gene consists of approximately 8kb and is split into four exons. This gene consists of 281aa with a calculated M(r) of 31,759 and was mapped on chromosome 1q23. It has an identity of 76.9% at the aa sequence level with mouse FasL. The FAS and FASL system plays a key role in regulating apoptotic cell death and corruption of this signalling pathway has been shown to participate in immune escape and tumorigenesis. FAS and FASL triggered apoptosis pathway plays an important role in human carcinogenesis. This system may also play a role in modulating the genetic susceptibility of mouse strains to develop T-cell lymphoblastic lymphomas.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human FASLG, aa1-281 (AAH17502.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FASLG.