124608-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG1,kClone Number
1E4Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
BC004108, AAH04108Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-CD316 (Immunoglobulin superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (FITC)
CD316 antigen forms highly proximal, specific, and stoichiometric complexes with CD81 and CD9. It may play a key role in the diverse functions of CD81 and CD9 such as oocytes fertilisation or hepaptitis C virus function. It may regulate proliferation and differentiation of keratinocytes and may negatively regulate cell motility. It may also participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain. CD316 antigen is a transmembrane protein that is expressed in brain, kidney, testis, liver and placenta with moderate expression in all other tissues. It is detected on a majority of B-cells, T-cells and natural killer cells but not on monocytes, polynuclear cells and platelets.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa220-322 from human CD316 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CD316.
