CD316 antigen forms highly proximal, specific, and stoichiometric complexes with CD81 and CD9. It may play a key role in the diverse functions of CD81 and CD9 such as oocytes fertilisation or hepaptitis C virus function. It may regulate proliferation and differentiation of keratinocytes and may negatively regulate cell motility. It may also participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain. CD316 antigen is a transmembrane protein that is expressed in brain, kidney, testis, liver and placenta with moderate expression in all other tissues. It is detected on a majority of B-cells, T-cells and natural killer cells but not on monocytes, polynuclear cells and platelets.

Suitable for use in FLISA. Other applications not tested.

Optimal dilutions to be determined by the researcher.

PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant protein corresponding to aa220-322 from human CD316 with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CD316.