Mouse Anti-CD32 (FCGR2A, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, IgG Fc Receptor II-a, FCGR2A, FCG2, FCGR2A1, IGFR2)
Fcg RII, also known as CD32, is a group of three closely related proteins (Fcg RIIA, Fcg RIIB, Fcg RIIC) that share greater than 94% aa identity in their extracellular domains. They function as transmembrane receptors for the Fc portion of IgG molecules. These proteins are expressed by various hematopoietic cells including monocytes, macrophages, neutrophils, NK cells, T cells, and B cells. The Fcg RII proteins are involved in phagocytosis of immune complexes and modulation of antibody production by B cells.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa46-150 from FCGR2A (AAH20823) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FCGR2A.
