T cell activation through the T cell antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3g, CD3d, CD3e and CD3Xi. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3e may play a role in TCR-induced growth arrest, cell survival and proliferation.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length recombinant corresponding to aa23-207 from human CD3E (AAH49847.1) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CD3E.