124654-ML550
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
MaxLight™550Isotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_001779.1, NP_001770.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Rabbit Anti-CD58 (Lymphocyte Function-associated Antigen 3, Ag3, Surface Glycoprotein LFA-3, LFA3) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
CD58, or LFA-3, is a membrane glycoprotein of 55-70kD. It occurs in two forms, one transmembrane with a cytoplasmic domain, the other form anchored in the membrane via a glycosylphosphatidylinositol tail. The complete amino acid sequence of both forms has been deduced from cDNA. It is heavily N-glycosylated. CD58 is a cell adhesion molecule which plays a critical role in facilitation of antigen specific recognition through interaction with CD2 on T lymphocytes. It is a member of the immunoglobulin superfamily of molecules.CD58 has a wide tissue distribution, being present on erythrocytes, platelets, monocytes, a subset of lymphocytes, bone marrow cells, epithelium and endothelial cells[2]. There are approximately 5,000 CD58 molecules on each erythrocyte. There is reduced expression of CD58 on haemopoietic cells in individuals with paroxysmal nocturnal haemoglobinuria.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human CD58, aa1-250 (NP_001770.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CD58.