CD79a, a 32-33KD membrane glycoprotein, is a member of Ig superfamily. It heterodimerizes with CD79b and is non-covalently cross-linked with surface Ig thus forming the BCR complex. It is expressed all stages of differentiation in mature B-cells and is required for cell surface expression and signal transduction by the BCR complex. Upon antigen binding, CD79a/b heterodimer interacts with Tyrosine kinase (Lyn) and gets phosphorylated, resulting in the inititation of intracellular signaling cascade. Pathological role of CD79a has been suggested in B-cell lymphomas and acute lymphoblastic leukemia. CD79a is often used along with CD20 in the detection of normal and neoplastic B-cells in tissue sections.

Suitable for use in Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length human CD79A, aa1-226 (NP_001774.1).

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CD79A.