Rabbit Anti-CD79a (B Cell Antigen Receptor Complex-associated Protein alpha Chain, Ig-alpha, MB-1 Membrane Glycoprotein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM-associated Protein, IGA, MB1)
CD79a, a 32-33KD membrane glycoprotein, is a member of Ig superfamily. It heterodimerizes with CD79b and is non-covalently cross-linked with surface Ig thus forming the BCR complex. It is expressed all stages of differentiation in mature B-cells and is required for cell surface expression and signal transduction by the BCR complex. Upon antigen binding, CD79a/b heterodimer interacts with Tyrosine kinase (Lyn) and gets phosphorylated, resulting in the inititation of intracellular signaling cascade. Pathological role of CD79a has been suggested in B-cell lymphomas and acute lymphoblastic leukemia. CD79a is often used along with CD20 in the detection of normal and neoplastic B-cells in tissue sections.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human CD79A, aa1-226 (NP_001774.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CD79A.
