The CD79 molecule, comprising two polypeptide chains, mb-1 (CD79a) and B29 (CD79b), is physically associated in the B-cell membrane with immunoglobulins to constitute the B cell antigen receptor (BCR). The CD79a/b heterodimer interacts with at least one tyrosine kinase (Lyn). Induction of tyrosine kinase activity after antigen binding causes phosphorylation of the CD79a/b dimer, and also of other molecules, thereby initiating intracellular signaling. Almost all acute lymphoblastic leukemias of precursor B cell type are positive when tested with CD79a antibodies.

Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length recombinant protein corresponding to aa1-229 from human CD79B with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CD79B.