124692-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG1,kClone Number
3G10-1F4Grade
Affinity PurifiedApplications
FLISA IP WBCrossreactivity
HuAccession #
BC030830, AAH30830Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15) (APC)
CD83 is a 45kD type I transmembrane protein. It belongs to immunoglobulin superfamily and is expressed on mature dendritic cells and activated lymphocytes. CD83 is involved in the regulation of T cell development and immune response. Soluble form CD83 has been reported to inhibit dendritic cell maturation and dendritic cell-mediated T cell proliferation. Murine CD83 ligand has been found on B cells.
Applications
Suitable for use in FLISA, Immunoprecipitation and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-205 from CD83 (AAH30830) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CD83.
