Mouse Anti-CD93 (C1QR1, C1qRP, CDw93, ECSM3, MXRA4, C1qR(P), dJ737E23.1, Complement Component C1Q Receptor, C1q/MBL/SPA Receptor, Complement Component 1 q Subcomponent Receptor 1, Matrix-remodeling-associated Protein 4) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
CD93 is a 110kD O-sialoglycoprotein, known as complement C1q receptor, C1qR1, C1qRp (C1q receptor precursor), or GR11. It is expression on monocytes, granulocytes, platelets, and endothelial cells. CD93 regulates phagocytosis of apoptosis cells, and leukocyte-endothelial cell adhesion.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa33-141 from C1QR1 (NP_036204) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human C1QR1.
