124740-Biotin
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
BiotinIsotype
IgG2a,kClone Number
1A9Grade
Affinity PurifiedApplications
E IFCrossreactivity
HuAccession #
NM_033531, NP_277073Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-CDK11A (Cyclin-dependent Kinase 11A, Cell Division Cycle 2-like Protein Kinase 2, Cell Division Protein Kinase 11A, Galactosyltransferase-associated Protein Kinase p58/GTA, PITSLRE Serine/Threonine-protein Kinase CDC2L2, CDC2L2, CDC2L3, PITSLREB) (Biotin)
Three major isoforms of Cdk11 identified are the full length gene product Cdk11p110 and the shorter polypeptides Cdk11p58 and Cdk11p46. Cdk11p110 is a component of RNA polymerase II containing complexes involved in transcriptional regulation, and is implicated in pre-mRNA splicing through interaction with the splicing factor RNPS1 (RNA-binding protein with serine-rich domain 1). Cdk11p58 has been linked with mitosis, cell cycle arrest and apoptosis, and recently implicated as a negative regulator of the androgen receptor (AR) as part of a cyclin D3/ Cdk11p58 complex. Cdk11p46 arises from the cleavage of Cdk11p110 and Cdk11p58 by caspases following the induction of apoptosis, and is linked with apoptotic progression.
Applications
Suitable for use in Immunofluorescence and ELISA. Other applications not tested.
Recommended Dilution
Sandwich ELISA: The detection limit is ~0.03ng/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa681-780 from human CDC2L2 (NP_277073) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CDC2L2.
