124798-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG2a,kClone Number
2D7Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC001968, AAH01968Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-CDK9 (Cyclin-dependent Kinase 9, C-2K, Cell Division Cycle 2-like Protein Kinase 4, Cell Division Protein Kinase 9, Serine/Threonine-protein Kinase PITALRE, CDC2L4) (FITC)
CDK9 (cyclin-dependent kinase 9, serine/threonine-protein kinase PITALRE) is a member of the cell division cycle 2 (CDC2) family of kinases that play a pivotal role in the regulation of the eukaryotic cell cycle. CDK9 expression is ubiquitous, but its expression levels are different in various human tissues. CDK9 is localized primarily to the nucleus. At pathophysiological levels, CDK9 activity suppresses many genes for mitochondrial proteins including master regulators of mitochondrial function (peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1), nuclear respiratory factor-1). Chronic activation of CDK9 causes not only cardiomyocyte enlargement but also defective mitochondrial function. The cyclinT/CDK9 complex, also called positive transcription elongation factor b (p-TEFb), phosphorylates the C-terminal domain of the large subunit of RNA polymerase II, stimulating transcription elongation and pre-mRNA processing.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa271-372 from human CDK9 (AAH01968) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CDK9.