Mouse Anti-CDKL2 (Cyclin-dependent Kinase-like 2, Protein Kinase p56 KKIAMRE, Serine/Threonine-protein Kinase KKIAMRE)
CDKL2 is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with a lower level in the nucleus.
Applications
Suitable for use in ELISA, Immunofluorescence, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.7ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa394-493 from CDKL2 (NP_003939) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CDKL2.