124817
Clone Type
MonoclonalHost
MouseSource
HumanIsotype
IgG2a,kClone Number
2D8Grade
Affinity PurifiedApplications
E IF WBCrossreactivity
HuAccession #
NM_001804, NP_001795Shipping Temp
Blue IceStorage Temp
-20°CMouse Anti-CDX1 (Homeobox Protein CDX-1, Caudal-type Homeobox Protein 1)
The caudal type homeo box transcription factor 1 (CDX1) and CDX2 are candidates for directing intestinal development, differentiation, and maintenance of the intestinal phenotype. CDX1 is a 265aa protein with 85% identity to mouse Cdx1 (98% identity, including conservative aa changes). CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. Decrease in human CDX1 and/or CDX2 expression is associated with colorectal tumorigenesis. On the other hand, increased CDX1 expression is associated with chronic atrophic gastritis.
Applications
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa126-215 from human CDX1 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CDX1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Activation of the BMP4 Pathway and Early Expression of CDX2 Characterize Non-specialized Columnar Metaplasia in a Human Model of Barrett's Esophagus. Castillo D, Puig S, Iglesias M, Seoane A, de Bolos C, Munitiz V, Parrilla P, Comerma L, Poulsom R, Krishnadath KK, Grande L, Pera M.J Gastrointest Surg. 2011 Nov 11.USBio References
No references available