Mouse Anti-CHEK1 (Serine/Threonine-protein Kinase Chk1, CHK1 Checkpoint Homolog, Cell Cycle Checkpoint Kinase, Checkpoint Kinase-1, CHK1)
The checkpoint kinases Chk1 is a serine/threonine kinase involved in the signal transduction mechanisms of the DNA damage response pathways in response to the activation of upstream kinases. In mammals, Chk1 is mainly regulated by the ATR kinase. Activated Chk1 phosphorylates and regulates different downstream targets, such as p53 and CDC25 phosphatases, promoting cell cycle arrest at G1/S and G2/M boundaries after DNA damage, and also S phase delay and inhibition of replication origin firing when DNA replication is blocked. Different studies showed Chk1 frameshift mutations in endometrial, colorectal, and stomach carcinomas with microsatellite instability.
Applications
Suitable for use in Immunofluorescence and ELISA. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa361-476 from human CHEK1 (AAH04202) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CHEK1.