Rabbit Anti-CHIA (Acidic Mammalian Chitinase, AMCase, Lung-specific Protein TSA1902)
CHIA degrades chitin and chitotriose. May participate in the defense against nematodes and other pathogens. There are 3 named isoforms produced by alternative splicing. CHIA is induced via a T helper-2 (Th2)-specific, interleukin-13-mediated pathway in epithelial cells and macrophages. CHIA may be an important mediator of IL13-induced responses in Th2-dominated disorders such as asthma. CHIA hydrolysis N-acetyl-beta-D-glucosaminide 1,4-beta-linkages in chitin and chitodextrins.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human CHIA, aa1-368 (NP_068569.2).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CHIA. Species Crossreactivity: mouse.
