Choline acetyltransferase is a neuronal enzyme which catalyzes the reaction between Acetyl CoA and choline resulting in the formation of acetylcholine. It is therefore found primarily in cholinergic neurons making it a valuable marker for diseases associated with decreased cholinergic function such as Schizophrenia, Alzheimer disease (AD) and Down syndrome (Holt et al. 1999). Decreased choline acetyltransferase activity in particular has been shown in Schizophrenic subjects (Karson et al 1993). It has furthermore been demonstrated that in patients with AD, there are significantly lower levels of cortical ChAT that correlate with severity of the disease as measured by loss of neuropsychological function (Baskin et al. 1999).

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa649-748 from human CHAT with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human CHAT.