125003-Biotin
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
BiotinIsotype
IgG2a,kClone Number
4B9Grade
Affinity PurifiedApplications
E IP WBCrossreactivity
HuAccession #
BC031896, AAH31896Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-CIDEA (Cell Death Activator CIDE-A, Cell Death-inducing DFFA-like Effector A, CIDE-A) (Biotin)
CIDEA is a 24-27kD member of the CIDE family of molecules. It is expressed in human adipocytes and striated muscle, plus mouse brown adipocytes and hepatocytes, and appears to have at least two functions. In the cytoplasm of fat cells, CIDEA localizes to lipid droplets and ER, and promotes the formation of lipid droplets at the expense of lipolysis and AMPK activity. In the nucleus, CIDEA apparently binds to LXR, and is capable of inducing apoptosis. CIDEA undergoes O-linked glycosylation. When glycosylated, CIDEA is nuclear; when nonglycosylated, CIDEA is cytoplasmic. Human CIDEA is 219aa in length, and contains one CIDE domain aa33-110 that potentially mediates dimerization. CIDEA reportedly homodimerizes, and heterodimerizes with CIDEB. There is one potential isoform variant that possesses a 46aa substitution for aa1-12. Over aa61-162, human CIDEA shares 89% aa identity with mouse CIDEA.
Applications
Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-253 from human CIDEA (AAH31896) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CIDEA.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Immunotherapeutic Potential of Anti-Human Endogenous Retrovirus-K Envelope Protein Antibodies in Targeting Breast Tumors. Wang-Johanning F, Rycaj K, Plummer JB, Li M, Yin B, Frerich K, Garza JG, Shen J, Lin K, Yan P, Glynn SA, Dorsey TH, Hunt KK, Ambs S, Johanning GL.J Natl Cancer Inst. 2012 Feb 8;104(3):189-210. Epub 2012 Jan 12. 2. Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes. Ito M, Nagasawa M, Omae N, Ide T, Akasaka Y, Murakami K.J Lipid Res. 2011 Jun 2. [Epub ahead of print] 3. Differential roles of CIDEA and CIDEC in insulin-induced anti-apoptosis and lipid droplet formation in human adipocytes. Ito M, Nagasawa M, Hara T, Ide T, Murakami K.J Lipid Res. 2010 Feb 14. [Epub ahead of print] 4. Cidea is associated with lipid droplets and insulin sensitivity in humans. Puri V, Ranjit S, Konda S, Nicoloro SM, Straubhaar J, Chawla A, Chouinard M, Lin C, Burkart A, Corvera S, Perugini RA, Czech MP.Proc Natl Acad Sci U S A. 2008 Jun 3;105(22):7833-8. Epub 2008 May 28.USBio References
No references available